Structure of PDB 7qi5 Chain 8 Binding Site BS02

Receptor Information

>7qi5 Chain 8 (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLD
KARERPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEA
LEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDIT
KVYTQVE

Ligand information

>7qi5 Chain Ax (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uagggaauaguuuaaaaaacaucugacucauauucagaagauggagguuc
aauuccuccuucccuaacca

<<<<<<<..<<<<...>>>>.<<<<<.......>>>>>....<<<<<...
....>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Resolution	2.63 Å
Binding residue (original residue number in PDB)	K59 R67 R70
Binding residue (residue number reindexed from 1)	K13 R21 R24

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0009653	anatomical structure morphogenesis
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum	7qi5
PubMed	38769321
UniProt	Q9NQ50\|RM40_HUMAN Large ribosomal subunit protein mL40 (Gene Name=MRPL40)

[Back to BioLiP]