Structure of PDB 5lzp Chain 8 Binding Site BS02

Receptor Information

>5lzp Chain 8 (length=215) Species: 83332 (Mycobacterium tuberculosis H37Rv)

SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL

Ligand information

>5lzp Chain 7 (length=5) Species: 83332 (Mycobacterium tuberculosis H37Rv)

TGQYL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5lzp Structural Analysis of the Bacterial Proteasome Activator Bpa in Complex with the 20S Proteasome.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): K28 K52 G66 K67 F68 E119
• Binding residue (residue number reindexed from 1): K21 K45 G59 K60 F61 E112

Enzymatic activity

• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0010498 proteasomal protein catabolic process
• GO:0019941 modification-dependent protein catabolic process
• GO:0030682 symbiont-mediated perturbation of host defenses
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005737 cytoplasm
• GO:0005839 proteasome core complex
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall
• GO:0019773 proteasome core complex, alpha-subunit complex

External links

• PDB: RCSB:5lzp, PDBe:5lzp, PDBj:5lzp
• PDBsum: 5lzp
• PubMed: 27839949
• UniProt: P9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)