Structure of PDB 5oqj Chain 7 Binding Site BS02

Receptor Information
>5oqj Chain 7 (length=408) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCT
SSVSVMQWRQQFLAAAAAAAAAAAAAAAAAAAAAAAAAALVVSTYSMVAN
AAAAAAAAAAAAAAAAAAAWGFIILDEVHVVPAAMFRRVVSTIAAHAKLG
LTATLVREDDKIGDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMT
AEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVFSDNV
YALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSI
DLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKD
TQEMYYSTKRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQE
VLLKNEEA
Ligand information
>5oqj Chain T (length=72) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttgtgctatgatatttttatgtatgtacaacacacatcggcgttccatag
ctattatatacacagcgtgcta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oqj Structures of transcription pre-initiation complex with TFIIH and Mediator.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		X440 X467 V657
Binding residue
(residue number reindexed from 1)		X78 X105 V295
Enzymatic activity
Enzyme Commision number 5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0004386 helicase activity
GO:0005524 ATP binding
GO:0015616 DNA translocase activity
GO:0016787 hydrolase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0043138 3'-5' DNA helicase activity
Biological Process
GO:0000019 regulation of mitotic recombination
GO:0001111 RNA polymerase II promoter clearance
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0032508 DNA duplex unwinding
Cellular Component
GO:0000112 nucleotide-excision repair factor 3 complex
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005675 transcription factor TFIIH holo complex
GO:0005829 cytosol
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oqj, PDBe:5oqj, PDBj:5oqj
PDBsum5oqj
PubMed29088706
UniProtQ00578|RAD25_YEAST General transcription and DNA repair factor IIH helicase/translocase subunit XPB/SSL2 (Gene Name=SSL2)

[Back to BioLiP]