Structure of PDB 8snb Chain 6R Binding Site BS02

Receptor Information
>8snb Chain 6R (length=72) Species: 7668 (Strongylocentrotus purpuratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPNWPKREQKPKLPFERTQPPLVYPGIRDMHNYSNLPQFTGKDLPMPKIP
NGEMGLRAPHVPHWDSTNHYSY
Ligand information
>8snb Chain 8Q (length=21) Species: 7668 (Strongylocentrotus purpuratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKLIKAPQRFTHGEWNYSNHA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8snb Structural specializations of the sperm tail.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K248 P252 P259 L260 V261 Y262 I265 K280 M284 N289 G293
Binding residue
(residue number reindexed from 1)		K10 P14 P21 L22 V23 Y24 I27 K42 M46 N51 G55
Enzymatic activity
Enzyme Commision number ?
External links