Structure of PDB 5el4 Chain 6E Binding Site BS02

Receptor Information
>5el4 Chain 6E (length=149) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRYQVPMEVSPRRQQSLALRWLVQ
AANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYR
Ligand information
>5el4 Chain 3K (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggucguuagcucaguugguagagcaguugacuuuuaaucaauuggucgc
agguucgaauccugcacgacccacca
<<<<.<<..<.<..........>.>.<<<<<.......>>>>>.......
<<<.......>>>..>>.>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5el4 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Resolution3.15 Å
Binding residue
(original residue number in PDB)
S77 Q86 D140 R143 M144 A147
Binding residue
(residue number reindexed from 1)
S76 Q80 D134 R137 M138 A141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5el4, PDBe:5el4, PDBj:5el4
PDBsum5el4
PubMed26791911
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]