Structure of PDB 5e81 Chain 6E Binding Site BS02

Receptor Information

>5e81 Chain 6E (length=154) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYR

Ligand information

>5e81 Chain 3K (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggucguuagcucagugagcaguugacuuuuaaucaauuggcgcagguuc
gaauccugcacgacccacca

<<<<.<<...<<<...>>>..<<<<<.......>>>>>.....<<<<...
....>>>>.>>.>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5e81 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	S77 R79 N84 R143 M144 A147
Binding residue (residue number reindexed from 1)	S76 R78 N83 R142 M143 A146

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5e81, PDBe:5e81, PDBj:5e81
PDBsum	5e81
PubMed	26791911
UniProt	P17291\|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]