Structure of PDB 5ndk Chain 65 Binding Site BS02

Receptor Information

>5ndk Chain 65 (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>5ndk Chain 1J (length=122)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga

..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5ndk Aminoglycoside interactions and impacts on the eukaryotic ribosome.
• Resolution: 2.95 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 Y36 Q38 G45 V46 T47 S50 A55 K57 K59 K62 T63 Y92 K93 H95 R97
• Binding residue (residue number reindexed from 1): R14 R24 F28 R29 S30 L31 Y35 Q37 G44 V45 T46 S49 A54 K56 K58 K61 T62 Y91 K92 H94 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5ndk, PDBe:5ndk, PDBj:5ndk
• PDBsum: 5ndk
• PubMed: 29208708
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)