Structure of PDB 8qu1 Chain 6 Binding Site BS02

Receptor Information
>8qu1 Chain 6 (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRTPPLGPMPNSDIDLSNLERLEKYRSFDRYRRRA
Ligand information
>8qu1 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qu1 GTPBP8 plays a role in mitoribosome formation in human mitochondria.
Resolution2.74 Å
Binding residue
(original residue number in PDB)		R52 S53 R56
Binding residue
(residue number reindexed from 1)		R26 S27 R30
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qu1, PDBe:8qu1, PDBj:8qu1
PDBsum8qu1
PubMed38969660
UniProtQ96DV4|RM38_HUMAN Large ribosomal subunit protein mL38 (Gene Name=MRPL38)

[Back to BioLiP]