Structure of PDB 7of0 Chain 6 Binding Site BS02

Receptor Information

>7of0 Chain 6 (length=324) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RRTPPLGPMPNSDIDLSNLERLEKYRSFDRYRRRAEQEAQAPHWWRTYRE
YFGRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGP
YHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTP
TEAAQAPEVTYEAELWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAEG
QVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSYQLAQRTFRTFDFYKK
HQETMTPAGLSFFQCRWDDSVTYIFHQLLDMREPVFEFVRPPPYHPKQKR
FPHRQPLRYLDRYRDSHEPTYGIY

Ligand information

>7of0 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga

<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7of0 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R52 S53 R56 R106 R114 R124 R126
Binding residue (residue number reindexed from 1)	R26 S27 R30 R61 R69 R79 R81

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005829	cytosol
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7of0, PDBe:7of0, PDBj:7of0
PDBsum	7of0
PubMed	34135319
UniProt	Q96DV4\|RM38_HUMAN Large ribosomal subunit protein mL38 (Gene Name=MRPL38)

[Back to BioLiP]