Structure of PDB 6swd Chain 6 Binding Site BS02

Receptor Information
>6swd Chain 6 (length=95) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIR
VGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKITQEFLTG
Ligand information
>6swd Chain 5 (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uggaggugauuuaaaugcca
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6swd Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R56 R57
Binding residue
(residue number reindexed from 1)		R44 R45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swd, PDBe:6swd, PDBj:6swd
PDBsum6swd
PubMed32029867
UniProtQ9V138|IF1A_PYRAB Translation initiation factor 1A (Gene Name=eIF1A)

[Back to BioLiP]