Structure of PDB 5el7 Chain 5I Binding Site BS02

Receptor Information

>5el7 Chain 5I (length=60) Species: 300852 (Thermus thermophilus HB8)

ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW

Ligand information

• Ligand ID: MG
• InChI: InChI=1S/Mg/q+2
• InChIKey: JLVVSXFLKOJNIY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Mg+2]
  CACTVS 3.341: [Mg++]
• Formula: Mg
• Name: MAGNESIUM ION
• DrugBank: DB01378
• PDB chain: 5el7 Chain 5I Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5el7 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Resolution: 3.15 Å
• Binding residue (original residue number in PDB): T22 A30
• Binding residue (residue number reindexed from 1): T21 A29
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 20:35:53 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5el7', asym_id = '5I', bs = 'BS02', title = 'Novel base-pairing interactions at the tRNA wobb...crucial for accurate reading of the genetic code.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5el7', asym_id='5I', bs='BS02', title='Novel base-pairing interactions at the tRNA wobb...crucial for accurate reading of the genetic code.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5el7', asym_id = '5I'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5el7', asym_id='5I')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>