Structure of PDB 7v08 Chain 5 Binding Site BS02

Receptor Information
>7v08 Chain 5 (length=73) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENER
YERLAAKMHAKKVERMRRREKRN
Ligand information
>7v08 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v08 rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Resolution2.36 Å
Binding residue
(original residue number in PDB)		H100 K103 R106 R109 R110
Binding residue
(residue number reindexed from 1)		H59 K62 R65 R68 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v08, PDBe:7v08, PDBj:7v08
PDBsum7v08
PubMed36864048
UniProtP53188|CGR1_YEAST rRNA-processing protein CGR1 (Gene Name=CGR1)

[Back to BioLiP]