Structure of PDB 7rr5 Chain 5 Binding Site BS02

Receptor Information
>7rr5 Chain 5 (length=154) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHG
HAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLM
NMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEA
ARTD
Ligand information
>7rr5 Chain P (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuccucguggcccaauggucacggcgucuggcuucgaaccagaagauucc
agguucaaguccuggcggggaagcca
<<<<<<<..<<<..........>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rr5 Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		R27 K48 X51 R87 E89 T137 A153 R155
Binding residue
(residue number reindexed from 1)		R24 K45 X48 R84 E86 T134 A150 R152
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 24 15:56:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7rr5', asym_id = '5', bs = 'BS02', title = 'Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7rr5', asym_id='5', bs='BS02', title='Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0003746,0043022,0045901,0045905', uniprot = '', pdbid = '7rr5', asym_id = '5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003746,0043022,0045901,0045905', uniprot='', pdbid='7rr5', asym_id='5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>