Structure of PDB 7naf Chain 5 Binding Site BS02

Receptor Information
>7naf Chain 5 (length=105) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRQILTRGKQSKKFGTDEVTFDKDSRLDYLTGFHKRKLQRQKKAQEFIKE
QERLRKIEERQKIRQERKEVMEEQLKTFKESLNLKFRYLTKNERRINQRK
ANDNK
Ligand information
>7naf Chain q (length=28) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LAQTLVNRGVNLQPLQIFDSQVPIGATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7naf Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution3.13 Å
Binding residue
(original residue number in PDB)		N6 R7 Q8
Binding residue
(residue number reindexed from 1)		N1 R2 Q3
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7naf, PDBe:7naf, PDBj:7naf
PDBsum7naf
PubMed36482249
UniProtQ04031|RRP17_YEAST Ribosomal RNA-processing protein 17 (Gene Name=RRP17)

[Back to BioLiP]