Structure of PDB 6ft6 Chain 5 Binding Site BS02

Receptor Information
>6ft6 Chain 5 (length=73) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENER
YERLAAKMHAKKVERMRRREKRN
Ligand information
>6ft6 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ft6 Structure of the nuclear exosome captured on a maturing preribosome.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		H100 K102 K103 R106 R109 R110
Binding residue
(residue number reindexed from 1)		H59 K61 K62 R65 R68 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ft6, PDBe:6ft6, PDBj:6ft6
PDBsum6ft6
PubMed29519915
UniProtP53188|CGR1_YEAST rRNA-processing protein CGR1 (Gene Name=CGR1)

[Back to BioLiP]