Structure of PDB 3jce Chain 5 Binding Site BS02

Receptor Information
>3jce Chain 5 (length=234) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN
Ligand information
>3jce Chain 9 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<...<<<<........>>>>.<<<<<.......>>>>>.....<<
<<.........>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jce EF4 disengages the peptidyl-tRNA CCA end and facilitates back-translocation on the 70S ribosome
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R53 K54 Q129 K141
Binding residue
(residue number reindexed from 1)		R53 K54 Q129 K141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jce, PDBe:3jce, PDBj:3jce
PDBsum3jce
PubMed26809121
UniProtP0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]