Structure of PDB 8h6j Chain 4R Binding Site BS02

Receptor Information

>8h6j Chain 4R (length=106) Species: 9606 (Homo sapiens)

EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK

Ligand information

>8h6j Chain 4A (length=125)

agcuuugcgcaguggcaguaucguagccaaugaggucuauccgaggcgcg
auuuugcuaauugaaaacuucccaauagccgugacgacuagucggcacug
gcaauuuuugacagucucgagacug

...................<<<<<.<<<.....<<.....>>..>>>>>>
>>.........................<<<<<<.<<<<..>>>>.>>>.>
>>.........<<<<<<<>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8h6j Atomic structures of human exon-defined spliceosome prior to activation.
• Resolution: 3.25 Å
• Binding residue (original residue number in PDB): W376 F384 C385 G386 D387 K411 V412 I413 Y424 G425 F426 R455 K456
• Binding residue (residue number reindexed from 1): W8 F16 C17 G18 D19 K43 V44 I45 Y56 G57 F58 R87 K88

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0048025 negative regulation of mRNA splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:8h6j, PDBe:8h6j, PDBj:8h6j
• PDBsum: 8h6j
• PubMed: 38658629
• UniProt: Q9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)