Structure of PDB 8h6k Chain 4K Binding Site BS02

Receptor Information
>8h6k Chain 4K (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENK
RENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAE
LRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDH
FNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAW
Ligand information
>8h6k Chain 5A (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagau
uuccguggagaggaacaacucugagucuuaacccaauuuuuugaggccuu
gcuuuggcaaggcua
.<<<..<<<<<<<<<<<........<<<<<<<<...........>>>>>>
>>...>>>>>>>>>>>......>>>...................<<<<<<
<<....>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R385 S386 R388 T389 K390
Binding residue
(residue number reindexed from 1)		R167 S168 R170 T171 K172
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0001527 microfibril
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005813 centrosome
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum8h6k
PubMed38658629
UniProtP55081|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)

[Back to BioLiP]