Structure of PDB 4wr6 Chain 4E Binding Site BS02

Receptor Information

>4wr6 Chain 4E (length=151) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
E

Ligand information

>4wr6 Chain 4K (length=15) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaugaacaaaaa

...............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wr6 Structural insights into the translational infidelity mechanism.
Resolution	3.05 Å
Binding residue (original residue number in PDB)	R15 F28
Binding residue (residue number reindexed from 1)	R11 F24

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wr6, PDBe:4wr6, PDBj:4wr6
PDBsum	4wr6
PubMed	26037619
UniProt	Q5SHQ5\|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]