Structure of PDB 5ib7 Chain 42 Binding Site BS02

Receptor Information
>5ib7 Chain 42 (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPL
AVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAG
AVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRK
Ligand information
>5ib7 Chain 4L (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagguaaaaauggaaaaaa
...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ib7 The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		R15 F26
Binding residue
(residue number reindexed from 1)		R12 F23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ib7, PDBe:5ib7, PDBj:5ib7
PDBsum5ib7
PubMed27174928
UniProtQ5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]