Structure of PDB 1q82 Chain 4 Binding Site BS02

Receptor Information

>1q82 Chain 4 (length=92) Species: 2238 (Haloarcula marismortui) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDG
KFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

Ligand information

InChI=1S/Mg/q+2

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Mg

Name

MAGNESIUM ION

PDB chain

1q82 Chain 4 Residue 8078 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1q82 Structural Insights Into Peptide Bond Formation
Resolution	2.98 Å
Binding residue (original residue number in PDB)	G45 G47 D49
Binding residue (residue number reindexed from 1)	G45 G47 D49
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1q82, PDBe:1q82, PDBj:1q82
PDBsum	1q82
PubMed	12185246
UniProt	P32411\|RL44E_HALMA Large ribosomal subunit protein eL42 (Gene Name=rpl44e)

[Back to BioLiP]