Structure of PDB 6ip6 Chain 3P Binding Site BS02

Receptor Information
>6ip6 Chain 3P (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Ligand information
>6ip6 Chain zz (length=163) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccccucccgggagagccauaguggucugcggaaccggugaguacaccgga
auugcgagauuugggcgugcccccgcgagacugcuagccgaguaguguug
ggucgcgaaaggccuugugguacugccugauagggugcuugcgagugccc
cgggaggucucgu
..<<<<<<<<<<<.<<<<<<<<<<.<<<<<<..<<<<<<....>>>>>><
<<<....>>>>.<<<<..>>>>>>>>>.>.>>>>>><<<.....<<....
....>>....>>>....>>>>.>><<<<....>>>><<...((((.>>>>
>>>>>>>.)))).
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ip6 HCV IRES Captures an Actively Translating 80S Ribosome.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		D34 K36 G39 Y41 S78 F79 R80 K82
Binding residue
(residue number reindexed from 1)		D33 K35 G38 Y40 S77 F78 R79 K81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ip6, PDBe:6ip6, PDBj:6ip6
PDBsum6ip6
PubMed31080011
UniProtP42677|RS27_HUMAN Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]