Structure of PDB 7c52 Chain 3 Binding Site BS02

Receptor Information

>7c52 Chain 3 (length=56) Species: 1050 (Thermochromatium tepidum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPV
SYQALG

Ligand information

InChI=1S/Ca/q+2

BHPQYMZQTOCNFJ-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Ca++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Ca+2]

Formula

Ca

Name

CALCIUM ION

PDB chain

7c52 Chain 3 Residue 102 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7c52 Crystal structure of a photosynthetic LH1-RC in complex with its electron donor HiPIP.
Resolution	2.89 Å
Binding residue (original residue number in PDB)	W46 D49 I51
Binding residue (residue number reindexed from 1)	W43 D46 I48
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7c52, PDBe:7c52, PDBj:7c52
PDBsum	7c52
PubMed	33597527
UniProt	D2Z0P2

[Back to BioLiP]