Structure of PDB 5umd Chain 3 Binding Site BS02

Receptor Information

>5umd Chain 3 (length=119) Species: 36329 (Plasmodium falciparum 3D7)

NVKAYELRTLKKKELLDKLDELKKELSGLRISKALGNSAKNSKIHGVRKN
VARVLTVYNQKRKMELRQLYKNKKFKPYNLRKKLTKNKRLQLSPKQKAAM
TLRQKKKVQNFPQRKYLVV

Ligand information

>5umd Chain C (length=151)

agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a

............................................<<<<<<
.((.....>>>.....<.<<<<..<<.)).>>.......>>>>..>...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): N3 K5 A6 Y7 K13 K14 K15 L18 K35 N43 S44 H47 R50 K51 A54 R55 L57 T58 Y60 N61 R64 K65 Y80 K85 T87 K88 R91
• Binding residue (residue number reindexed from 1): N1 K3 A4 Y5 K11 K12 K13 L16 K33 N41 S42 H45 R48 K49 A52 R53 L55 T56 Y58 N59 R62 K63 Y78 K83 T85 K86 R89

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5umd, PDBe:5umd, PDBj:5umd
• PDBsum: 5umd
• PubMed: 28288098
• UniProt: Q8IIB4