Structure of PDB 7jqm Chain 2Z Binding Site BS02

Receptor Information
>7jqm Chain 2Z (length=160) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELA
VSPEETIAAV
Ligand information
>7jqm Chain 2B (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga
.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<........<<<<<<<....>>>>>>>...
.....>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jqm Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		R10 K14 R19 Y29 N30 R31 N34 R72 Q73 R79 E84 H85 D87
Binding residue
(residue number reindexed from 1)		R10 K14 R19 Y29 N30 R31 N34 R72 Q73 R79 E84 H85 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jqm, PDBe:7jqm, PDBj:7jqm
PDBsum7jqm
PubMed32787108
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]