Structure of PDB 8g2b Chain 2S Binding Site BS02

Receptor Information

>8g2b Chain 2S (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>8g2b Chain 2B (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8g2b Structural basis of Cfr-mediated antimicrobial resistance and mechanisms to evade it
• Resolution: 2.55 Å
• Binding residue (original residue number in PDB): K11 R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 V46 T47 K62 T63 K93 H95 R97
• Binding residue (residue number reindexed from 1): K9 R13 R23 F27 R28 S29 L30 K31 H32 Y34 Q36 V44 T45 K60 T61 K91 H93 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8g2b, PDBe:8g2b, PDBj:8g2b
• PDBsum: 8g2b
• PubMed: 38238495
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)