Structure of PDB 8cvk Chain 2S Binding Site BS02

Receptor Information

>8cvk Chain 2S (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>8cvk Chain 2B (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8cvk Insights into the ribosome function from the structures of non-arrested ribosome-nascent chain complexes.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 L54 A55 K62 T63 Y92 K93 H95 R97
• Binding residue (residue number reindexed from 1): R13 R23 F27 R28 S29 L30 K31 H32 Y34 Q36 G43 V44 T45 L52 A53 K60 T61 Y90 K91 H93 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cvk, PDBe:8cvk, PDBj:8cvk
• PDBsum: 8cvk
• PubMed: 36316410
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)