Structure of PDB 7rq9 Chain 2S Binding Site BS02

Receptor Information

>7rq9 Chain 2S (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>7rq9 Chain 2B (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7rq9 A synthetic antibiotic class overcoming bacterial multidrug resistance.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): K11 R15 R25 F29 R30 S31 L32 H34 Q38 G45 V46 T47 S50 L54 G60 N61 K62 T63 K93 H95 R97
• Binding residue (residue number reindexed from 1): K9 R13 R23 F27 R28 S29 L30 H32 Q36 G43 V44 T45 S48 L52 G58 N59 K60 T61 K91 H93 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7rq9, PDBe:7rq9, PDBj:7rq9
• PDBsum: 7rq9
• PubMed: 34707295
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)