Structure of PDB 5j4b Chain 2S Binding Site BS02

Receptor Information

>5j4b Chain 2S (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>5j4b Chain 2B (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5j4b Insights into RNA binding by the anticancer drug cisplatin from the crystal structure of cisplatin-modified ribosome.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S50 K62 T63 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R13 R23 F27 R28 S29 L30 K31 H32 Y34 Q36 G43 V44 T45 S48 K60 T61 K91 H93 G94 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5j4b, PDBe:5j4b, PDBj:5j4b
• PDBsum: 5j4b
• PubMed: 27079977
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)