Structure of PDB 6ip6 Chain 2R Binding Site BS02

Receptor Information
>6ip6 Chain 2R (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESA
MKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGKKAY
VRLAPDYDALDVANKIGII
Ligand information
>6ip6 Chain 1C (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>.............>>>..)...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ip6 HCV IRES Captures an Actively Translating 80S Ribosome.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		K63 P66 N69 K103 Q108
Binding residue
(residue number reindexed from 1)		K27 P30 N33 K67 Q72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0045296 cadherin binding
GO:1904841 TORC2 complex binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ip6, PDBe:6ip6, PDBj:6ip6
PDBsum6ip6
PubMed31080011
UniProtP62750|RL23A_HUMAN Large ribosomal subunit protein uL23 (Gene Name=RPL23A)

[Back to BioLiP]