Structure of PDB 7u2i Chain 2G Binding Site BS02

Receptor Information

>7u2i Chain 2G (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>7u2i Chain 2B (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7u2i Structural basis for the inability of chloramphenicol to inhibit peptide bond formation in the presence of A-site glycine.
• Resolution: 2.55 Å
• Binding residue (original residue number in PDB): N27 W29 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98
• Binding residue (residue number reindexed from 1): N26 W28 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7u2i, PDBe:7u2i, PDBj:7u2i
• PDBsum: 7u2i
• PubMed: 35766409
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)