Structure of PDB 6n9e Chain 2G Binding Site BS02

Receptor Information

>6n9e Chain 2G (length=181) Species: 274 (Thermus thermophilus)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>6n9e Chain 2B (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<.....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>..>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6n9e Mechanistic insights into the slow peptide bond formation with D-amino acids in the ribosomal active site.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): P2 N27 W29 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98
• Binding residue (residue number reindexed from 1): P1 N26 W28 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n9e, PDBe:6n9e, PDBj:6n9e
• PDBsum: 6n9e
• PubMed: 30520988
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)