Structure of PDB 6gsk Chain 22 Binding Site BS02

Receptor Information

>6gsk Chain 22 (length=197) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGL
ARVDIERAADNVAVTVHVAKPGVVIRVLREELAKLTGKNVALNVQEVQNP
NLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGG
AEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGE

Ligand information

>6gsk Chain 4L (length=14) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaugaucaaaa

..............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gsk Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
Resolution	3.36 Å
Binding residue (original residue number in PDB)	Q162 R164
Binding residue (residue number reindexed from 1)	Q153 R155

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gsk, PDBe:6gsk, PDBj:6gsk
PDBsum	6gsk
PubMed	29931292
UniProt	P80372\|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]