Structure of PDB 5ib7 Chain 22 Binding Site BS02

Receptor Information
>5ib7 Chain 22 (length=195) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGL
ARVDIERAADNVAVTVHVAKPGVVIRVLREELAKLTGKNVALNVQEVQNP
NLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGG
AEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFL
Ligand information
>5ib7 Chain 4L (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagguaaaaauggaaaaaa
...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ib7 The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
Q162 R164
Binding residue
(residue number reindexed from 1)
Q153 R155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5ib7, PDBe:5ib7, PDBj:5ib7
PDBsum5ib7
PubMed27174928
UniProtP80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]