Structure of PDB 7p7q Chain 2 Binding Site BS02

Receptor Information
>7p7q Chain 2 (length=57) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELKITLKRSVIGRPQNQRATVKALGLGKVNSTVTKPANEAIKGMVNTIS
HLVDVEE
Ligand information
>7p7q Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugguggcgauagcgagaaggauacaccuguucccaugccgaacacagaa
guuaagcuucuuagcgccgauuguagugaaggguuucccuuugugagagu
aggacgucgccacg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>......
.>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p7q Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R15 Q19 H52
Binding residue
(residue number reindexed from 1)		R14 Q18 H51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7q, PDBe:7p7q, PDBj:7p7q
PDBsum7p7q
PubMed35387982
UniProtQ839E6|RL30_ENTFA Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]