Structure of PDB 6o97 Chain 1t Binding Site BS02

Receptor Information

>6o97 Chain 1t (length=96) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGG

Ligand information

• Ligand ID: MG
• InChI: InChI=1S/Mg/q+2
• InChIKey: JLVVSXFLKOJNIY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Mg+2]
  CACTVS 3.341: [Mg++]
• Formula: Mg
• Name: MAGNESIUM ION
• DrugBank: DB01378
• PDB chain: 6o97 Chain 1t Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6o97 Design, Multigram Synthesis, and in Vitro and in Vivo Evaluation of Propylamycin: A Semisynthetic 4,5-Deoxystreptamine Class Aminoglycoside for the Treatment of Drug-Resistant Enterobacteriaceae and Other Gram-Negative Pathogens.
• Resolution: 2.75 Å
• Binding residue (original residue number in PDB): A67 L72
• Binding residue (residue number reindexed from 1): A60 L65
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6o97, PDBe:6o97, PDBj:6o97
• PDBsum: 6o97
• PubMed: 30793894
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)