Structure of PDB 8ugp Chain 1q Binding Site BS02

Receptor Information
>8ugp Chain 1q (length=37) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGSMVPPEWHRWLHCMTYIWHKFNVSGQQYVPYSTTR
Ligand information
>8ugp Chain 1R (length=26) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
THTGQRQKEVNENFADGGGGALGHPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Q122 Q123 Y124 V125 P126 Y127 S128 T129
Binding residue
(residue number reindexed from 1)		Q28 Q29 Y30 V31 P32 Y33 S34 T35
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane

View graph for
Cellular Component
External links
PDB RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum8ugp
PubMed38811722
UniProtA0A4X1SJF2

[Back to BioLiP]