Structure of PDB 8vtv Chain 1l Binding Site BS02

Receptor Information
>8vtv Chain 1l (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
K47 P48
Binding residue
(residue number reindexed from 1)
K43 P44
External links
PDB RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum8vtv
PubMed39039256
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]