Structure of PDB 8g2b Chain 1g Binding Site BS02

Receptor Information
>8g2b Chain 1g (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW
Ligand information
>8g2b Chain 1y (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucaggguagagcaggggauugaaaauccccguguccuug
guucgauuccgaguccgggcacca
<<<<<<<..<<<<......>>>>.<<<<<<.....>>>>>>.....<<<<
<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g2b Structural basis of Cfr-mediated antimicrobial resistance and mechanisms to evade it
Resolution2.55 Å
Binding residue
(original residue number in PDB)
N84 Q86 D140 R143 M144 A147
Binding residue
(residue number reindexed from 1)
N83 Q85 D139 R142 M143 A146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8g2b, PDBe:8g2b, PDBj:8g2b
PDBsum8g2b
PubMed38238495
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]