Structure of PDB 8fc3 Chain 1Z Binding Site BS02

Receptor Information
>8fc3 Chain 1Z (length=203) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAEVAEPEVIKKG
KEE
Ligand information
>8fc3 Chain 1B (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga
.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fc3 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R10 P15 R19 Y29 N30 R31 N34 R72 Q73 N75 R79 R80 H85 D87
Binding residue
(residue number reindexed from 1)		R10 P15 R19 Y29 N30 R31 N34 R72 Q73 N75 R79 R80 H85 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fc3, PDBe:8fc3, PDBj:8fc3
PDBsum8fc3
PubMed37452045
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]