Structure of PDB 6n9e Chain 1Z Binding Site BS02

Receptor Information

>6n9e Chain 1Z (length=154) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVEIHRDILVKVSPRNIPEFIEVDVIGDSLHASDLKLPPGVELAVSP
EETI

Ligand information

>6n9e Chain 1B (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<.....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>..>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6n9e Mechanistic insights into the slow peptide bond formation with D-amino acids in the ribosomal active site.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	R10 K14 R19 Y29 N30 R31 N34 R72 Q73 R79 E84 H85 D87 F89
Binding residue (residue number reindexed from 1)	R10 K14 R19 Y29 N30 R31 N34 R72 Q73 R79 E84 H85 D87 F89

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n9e, PDBe:6n9e, PDBj:6n9e
PDBsum	6n9e
PubMed	30520988
UniProt	Q5SHZ1\|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]