Structure of PDB 8ugp Chain 1I Binding Site BS02

Receptor Information
>8ugp Chain 1I (length=126) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATINYPEKGPLSPRFRGEHALRRYPGEERCIACKLCEAVCPAQAITIEAE
PRSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYN
KEKLLNNGDKWEAEIAANIQADYLYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H144 L148
Binding residue
(residue number reindexed from 1)		H94 L98
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum8ugp
PubMed38811722
UniProtA0A286ZUN9

[Back to BioLiP]