Structure of PDB 5v8i Chain 1G Binding Site BS02

Receptor Information

>5v8i Chain 1G (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>5v8i Chain 1B (length=118)

ccccgugcccauagcggcguggaaccacccguucccauuccgaacacgga
agugaaacgcgccagcgccgaugguacugggcgggcgaccgccugggaga
guaggucggugcggggga

<<<<<<<<<....<<<<<<<<....<<<<<<...............>>>.
.>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>....
...>>>.>>>>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17
• Resolution: 3.25 Å
• Binding residue (original residue number in PDB): P2 N27 W29 Q66 K67 V70 R91 V92 T93 R95 R96 R98
• Binding residue (residue number reindexed from 1): P1 N26 W28 Q65 K66 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
• PDBsum: 5v8i
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)