Structure of PDB 8ugp Chain 1D Binding Site BS02

Receptor Information

>8ugp Chain 1D (length=221) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PAAHGVLRLDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQA
YSLAVELLPAQIRVLFGEITRLLNHIMAVTTHALDMPFFWMFEEREKMFE
FYERVSGARMHAAYIRPGGVHQDLPLLISGRMEIKVDDAKVSPPKRAEMK
TSMESLIHHFKLYTEGYQVYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAP
GFAHLAVIIGTQDIVFGEVDR

Ligand information

>8ugp Chain 1H (length=4) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ESEV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	D160 F168
Binding residue (residue number reindexed from 1)	D85 F89

Gene Ontology

	Molecular Function
GO:0051539	4 iron, 4 sulfur cluster binding

View graph for
Molecular Function

External links

PDB	RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum	8ugp
PubMed	38811722
UniProt	A0A8D0QM68

[Back to BioLiP]