Structure of PDB 8ugp Chain 1B Binding Site BS02

Receptor Information
>8ugp Chain 1B (length=118) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPQSDVMIVAGTLTNK
MAPALRKVYDQMRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG
CPPTAEALLYGILQLQRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P184 D187 S198
Binding residue
(residue number reindexed from 1)		P21 D24 S35
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:1902600 proton transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum8ugp
PubMed38811722
UniProtA0A4X1VVS8

[Back to BioLiP]