Structure of PDB 9b00 Chain 11 Binding Site BS02

Receptor Information
>9b00 Chain 11 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL
Ligand information
>9b00 Chain 1y (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucaggguagagcaggggauugaaaauccccguguccuug
guucgauuccgaguccgggcacca
<<<<<<<..<<<<......>>>>.<<<<<<.....>>>>>>.....<<<<
<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K23 V30
Binding residue
(residue number reindexed from 1)		K22 V29
External links
PDB RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum9b00
PubMed39019034
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]