Structure of PDB 7og4 Chain 1 Binding Site BS02

Receptor Information
>7og4 Chain 1 (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVEKKKI
RSL
Ligand information
>7og4 Chain r3 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuuaaauaauuuaauuaauaaaauaaaaaauuaaaaauuuuuauauuuu
uaauuuaauuuuaaauuuaaauaau
<<<<<<<....<<.........>>...<<<<.......>>.>>.....<<
<<<.......>>>>>>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7og4 Structural basis of mitochondrial translation.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R36 K61 I62
Binding residue
(residue number reindexed from 1)		R24 K49 I50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7og4, PDBe:7og4, PDBj:7og4
PDBsum7og4
PubMed32812867
UniProtO75394|RM33_HUMAN Large ribosomal subunit protein bL33m (Gene Name=MRPL33)

[Back to BioLiP]