Structure of PDB 6w6l Chain 1 Binding Site BS02

Receptor Information
>6w6l Chain 1 (length=426) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIM
SSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGD
TPKDRALFNGAQKLFGMIITIGQSIVYVMSGICLLITIQLFVAGLIVLLL
DELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIA
LFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDL
PIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFPVG
GLCHYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKD
VAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLG
AIGSGTGILLAVTIIYQYFEIFVKEQ
Ligand information
>6w6l Chain 3 (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VGPVPVLVMSLLFIASVFMLHIWGKYTRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w6l An ER translocon for multi-pass membrane protein biogenesis.
Resolution3.84 Å
Binding residue
(original residue number in PDB)		P22 W34 L50 Q154 G172
Binding residue
(residue number reindexed from 1)		P18 W30 L46 Q139 G157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005048 signal sequence binding
GO:0005262 calcium channel activity
GO:0005515 protein binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006613 cotranslational protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
GO:0007029 endoplasmic reticulum organization
GO:0015031 protein transport
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0039019 pronephric nephron development
GO:0045047 protein targeting to ER
GO:0045048 protein insertion into ER membrane
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005784 Sec61 translocon complex
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6l, PDBe:6w6l, PDBj:6w6l
PDBsum6w6l
PubMed32820719
UniProtP61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 (Gene Name=SEC61A1)

[Back to BioLiP]