Structure of PDB 7q0f Chain 0 Binding Site BS02

Receptor Information
>7q0f Chain 0 (length=171) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRLNEYQVIGRNLPTESVPEPKLFRMRIFAPNTVVAKSRYWYFLQKLHKV
KKASGEIVSVNIISEAKPTKVKTFGIWLRYESRSGIHNMYKEYRDVTRVG
AVETMYQDLAARHRARFRSIHILKVVELEKTDDVKRQYVKQFLTKDLKFP
LPHRVQKSKKLFQATAPTTFY
Ligand information
>7q0f Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution2.64 Å
Binding residue
(original residue number in PDB)
S39 R40 Y43 Q46 H49 K50 K52 K53 E82 R84 R119
Binding residue
(residue number reindexed from 1)
S38 R39 Y42 Q45 H48 K49 K51 K52 E81 R83 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009986 cell surface
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum7q0f
PubMed35613268
UniProtA0A1D8PLC9|RL20B_CANAL Large ribosomal subunit protein eL20 (Gene Name=RPL20B)

[Back to BioLiP]