Structure of PDB 7q08 Chain 0 Binding Site BS02

Receptor Information

>7q08 Chain 0 (length=171) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SRLNEYQVIGRNLPTESVPEPKLFRMRIFAPNTVVAKSRYWYFLQKLHKV
KKASGEIVSVNIISEAKPTKVKTFGIWLRYESRSGIHNMYKEYRDVTRVG
AVETMYQDLAARHRARFRSIHILKVVELEKTDDVKRQYVKQFLTKDLKFP
LPHRVQKSKKLFQATAPTTFY

Ligand information

>7q08 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution	2.56 Å
Binding residue (original residue number in PDB)	S39 Y43 Q46 H49 K50 K52 K53 E82 R84 R117 R119
Binding residue (residue number reindexed from 1)	S38 Y42 Q45 H48 K49 K51 K52 E81 R83 R116 R118

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009986	cell surface
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q08, PDBe:7q08, PDBj:7q08
PDBsum	7q08
PubMed	35613268
UniProt	A0A1D8PLC9\|RL20B_CANAL Large ribosomal subunit protein eL20 (Gene Name=RPL20B)

[Back to BioLiP]